FANDOM


Irc 188194 1387410210 S1 jermainiac

jermaniac's cow eye crystallin from Puzzle 821.

Cow Eye is a Foldit revisiting puzzle, originally presented as Puzzle 89: Cow Eye in 2008.

The protein in this puzzle is type of crystallin, a transparent protein found in eyes. As the puzzle name implies, this particular protein is found in cow eyes. There are several types of crystallin, and this protein is considered a "gamma b" type.

The puzzle protein has 88 segments with the sequence:

tfrmriyerddfrgqmseitddcpslqdrfhltevhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfy

The sequence is found in these Protein Data Bank entries:

  • 4W9B (chain A, offset 87)
  • 4W9A (chain A, offset 87)
  • 4GCR (chain A, offset 86)
  • 1I5I (chain A, offset 86)
  • 1GCS (chain A, offset 86)
  • 1DSL (chain A, offset 60)
  • 1AMM (chain A, offset 86)

The puzzle protein does not have any disulfide bridges.

This puzzle does not have any ligands.

This puzzle has a single chain.

See players' solutions from previous visits this puzzle: