Scorpion toxins have been a popular subject for Foldit puzzles. They tend to fold into structures with many disulfide bridges, three beta sheets, and an alpha helix. The wikipedia article scorpion toxin is a good place for examples.
Three different scorpion toxins are regularly seen as revisiting puzzles. See Revisiting Puzzle: Scorpion Toxin for details.
A classic of Foldit!
New player puzzle[]
The toxin in the early Foldit puzzle seen here is from Pandinus imperator, and has only 35 residues with the sequence:
tisctnpkqcyphckketgypnakcmnrkckcfgr
It is shorter than the usual three-sheet toxins.
This sequence is found in the PDB as 2PTA.
The protein can have three disulfide bridges, at 7-28, 13-33, and 17-35.
This protein was last seen in New Player Puzzle 2: Scorpion Toxin in 2011.
native in jmol by AA
native in jmol rainbow
S2 PaulDunn
S2 PaulDunn
S7 rav
S7 rav
S7 rav
S8 jermainiac
S14 inf15 ChrissyH
S14 inf15 ChrissyH